SCOPe 2.08: Domain d5wskd1: 5wsk D:22-149

Lineage for d5wskd1 (5wsk D:22-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Wheat (Triticum aestivum) [TaxId:4565] [348224] (1 PDB entry)

8. Domain d5wskd1: 5wsk D:22-149 [348337]
   Other proteins in same PDB: d5wska2, d5wskb2, d5wskc2, d5wskd2, d5wske_, d5wskf_, d5wskg_, d5wskh_
   automated match to d1ir2u2
   complexed with mg

Details for d5wskd1

PDB Entry: 5wsk, 1.78 Å

PDB Description: structure of ribulose-1,5-bisphosphate carboxylase/oxygenase from wheat

PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5wskd1:

Sequence; same for both SEQRES and ATOM records:

>d5wskd1 d.58.9.0 (D:22-149) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
ltyytpeyetkdtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltsldryk
grcyhiepvagedsqwicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
ptysktfq

Timeline for d5wskd1:

• d5wskd1 first appeared in SCOPe 2.07