Lineage for d5wskd1 (5wsk D:22-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953318Species Wheat (Triticum aestivum) [TaxId:4565] [348224] (1 PDB entry)
  8. 2953322Domain d5wskd1: 5wsk D:22-149 [348337]
    Other proteins in same PDB: d5wska2, d5wskb2, d5wskc2, d5wskd2, d5wske_, d5wskf_, d5wskg_, d5wskh_
    automated match to d1ir2u2
    complexed with mg

Details for d5wskd1

PDB Entry: 5wsk (more details), 1.78 Å

PDB Description: structure of ribulose-1,5-bisphosphate carboxylase/oxygenase from wheat
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5wskd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wskd1 d.58.9.0 (D:22-149) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
ltyytpeyetkdtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltsldryk
grcyhiepvagedsqwicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
ptysktfq

SCOPe Domain Coordinates for d5wskd1:

Click to download the PDB-style file with coordinates for d5wskd1.
(The format of our PDB-style files is described here.)

Timeline for d5wskd1: