Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Caulobacter crescentus [TaxId:190650] [337115] (3 PDB entries) |
Domain d5wypa3: 5wyp A:251-372 [348333] automated match to d5wcea3 |
PDB Entry: 5wyp (more details), 1.8 Å
SCOPe Domain Sequences for d5wypa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wypa3 d.131.1.0 (A:251-372) automated matches {Caulobacter crescentus [TaxId: 190650]} mrviprdnakiltldndlfakavdrvatisaeksrsvklavepgritltvrnmeagqave evevdydgepfeigfnarylldvcgqiagpqaefrfadpasptlvvdpvdpgvkyvlmpl rv
Timeline for d5wypa3: