Lineage for d5wypa2 (5wyp A:119-250)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2540275Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2540276Protein automated matches [226907] (28 species)
    not a true protein
  7. 2540335Species Caulobacter crescentus [TaxId:190650] [337115] (3 PDB entries)
  8. 3048270Domain d5wypa2: 5wyp A:119-250 [348332]
    automated match to d5wcea2

Details for d5wypa2

PDB Entry: 5wyp (more details), 1.8 Å

PDB Description: crystal structure of dna polymerase sliding clamp from caulobacter crescentus
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5wypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wypa2 d.131.1.0 (A:119-250) automated matches {Caulobacter crescentus [TaxId: 190650]}
vmssdglssriavdtnelirlidktrfaisteetryylnglyvhtvneggetklravatd
ghrlalaempapegavgipgvivprktiaearrlmesagetvdlqvspqkvrfefgaaal
tskvidgafpdy

SCOPe Domain Coordinates for d5wypa2:

Click to download the PDB-style file with coordinates for d5wypa2.
(The format of our PDB-style files is described here.)

Timeline for d5wypa2:

  • d5wypa2 is new in SCOPe 2.07-stable