Lineage for d5wypa1 (5wyp A:1-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583838Species Caulobacter crescentus [TaxId:190650] [337115] (3 PDB entries)
  8. 2583839Domain d5wypa1: 5wyp A:1-118 [348331]
    automated match to d5wcea1

Details for d5wypa1

PDB Entry: 5wyp (more details), 1.8 Å

PDB Description: crystal structure of dna polymerase sliding clamp from caulobacter crescentus
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5wypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wypa1 d.131.1.0 (A:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]}
mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
idvpgqitapahtlyeivrklpdgadvslsfsgddprlviqagrsrfnlpvlpagdfp

SCOPe Domain Coordinates for d5wypa1:

Click to download the PDB-style file with coordinates for d5wypa1.
(The format of our PDB-style files is described here.)

Timeline for d5wypa1:

  • d5wypa1 is new in SCOPe 2.07-stable
  • d5wypa1 does not appear in SCOPe 2.08