Lineage for d5wzoa_ (5wzo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346343Protein automated matches [190139] (27 species)
    not a true protein
  7. 2346462Species Human (Homo sapiens) [TaxId:9606] [260458] (13 PDB entries)
  8. 2346471Domain d5wzoa_: 5wzo A: [348322]
    automated match to d3u8da_
    complexed with b3p, ca, cl, gol

Details for d5wzoa_

PDB Entry: 5wzo (more details), 1.9 Å

PDB Description: crystal structure of human secreted phospholipase a2 group iie, crystallized with calcium
PDB Compounds: (A:) Group IIE secretory phospholipase A2

SCOPe Domain Sequences for d5wzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wzoa_ a.133.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlvqfgvmiekmtgksalqyndygcycgiggshwpvdqtdwcchahdccygrleklgcep
klekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgpt
ppc

SCOPe Domain Coordinates for d5wzoa_:

Click to download the PDB-style file with coordinates for d5wzoa_.
(The format of our PDB-style files is described here.)

Timeline for d5wzoa_: