SCOPe 2.06: Domain d1drab_: 1dra B:

Lineage for d1drab_ (1dra B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Escherichia coli [TaxId:562] [53600] (79 PDB entries)

8. Domain d1drab_: 1dra B: [34832]
   complexed with ca, cl, mtx

Details for d1drab_

PDB Entry: 1dra, 1.9 Å

PDB Description: crystal structure of unliganded escherichia coli dihydrofolate reductase. ligand-induced conformational changes and cooperativity in binding

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1drab_:

Sequence; same for both SEQRES and ATOM records:

>d1drab_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpaelawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1drab_:

• d1drab_ first appeared (with stable ids) in SCOP 1.55
  
• d1drab_ appears in SCOPe 2.05
  
• d1drab_ appears in SCOPe 2.07
  
• d1drab_ appears in the current release, SCOPe 2.08