SCOP 1.59: Domain d1drab_: 1dra B:

Lineage for d1drab_ (1dra B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d1drab_: 1dra B: [34832]

Details for d1drab_

PDB Entry: 1dra, 1.9 Å

PDB Description: crystal structure of unliganded escherichia coli dihydrofolate reductase. ligand-induced conformational changes and cooperativity in binding

SCOP Domain Sequences for d1drab_:

Sequence; same for both SEQRES and ATOM records:

>d1drab_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpaelawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1drab_:

• d1drab_ first appeared (with stable ids) in SCOP 1.55
  
• d1drab_ appears in SCOP 1.57
  
• d1drab_ appears in SCOP 1.61
  
• d1drab_ appears in the current release, SCOPe 2.08