Lineage for d5vd4a_ (5vd4 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d5vd4a_: 5vd4 A: [348310]
    automated match to d2z2wa_
    complexed with 99j, cl, edo, po4

Details for d5vd4a_

PDB Entry: 5vd4 (more details), 2.02 Å

PDB Description: crystal structure of human wee1 kinase domain in complex with rac-iv- 016, a mk1775 analougue
PDB Compounds: (A:) Wee1-like protein kinase

SCOPe Domain Sequences for d5vd4a_:

Sequence, based on SEQRES records: (download)

>d5vd4a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalrevyahav
lgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdlllqvgr
glryihsmslvhmdikpsnifisrtsipnaaseegdeddwasnkvmfkigdlghvtriss
pqveegdsrflanevlqenythlpkadifalaltvvcaagaeplprngdqwheirqgrlp
ripqvlsqeftellkvmihpdperrpsamalvkhsvlls

Sequence, based on observed residues (ATOM records): (download)

>d5vd4a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sryttefhelekigsgefgsvfkcvkrldgciyaikrskkplagsvdeqnalrevyahav
lgqhshvvryfsawaeddhmliqneycnggsladaisenyrimsyfkeaelkdlllqvgr
glryihsmslvhmdikpsnifisrtkvmfkigdlghvtrisspqveegdsrflanevlqe
nythlpkadifalaltvvcaagaeplprngdqwheirqgrlpripqvlsqeftellkvmi
hpdperrpsamalvkhsvlls

SCOPe Domain Coordinates for d5vd4a_ are not available.

Timeline for d5vd4a_: