| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
| Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species) |
| Species Escherichia coli [TaxId:562] [53600] (61 PDB entries) |
| Domain d1draa_: 1dra A: [34831] complexed with ca, cl, mtx |
PDB Entry: 1dra (more details), 1.9 Å
SCOPe Domain Sequences for d1draa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1draa_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpaelawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d1draa_: