Lineage for d1rf7__ (1rf7 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d1rf7__: 1rf7 - [34830]
Details for d1rf7__
PDB Entry: 1rf7 (more details), 1.8 Å
PDB Description: structure of dihydrofolate reductase complexed with dihydrofolate
SCOP Domain Sequences for d1rf7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rf7__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d1rf7__:
Click to download the PDB-style file with coordinates for d1rf7__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rf7__:
- d1rf7__ appears in SCOP 1.57
- d1rf7__ appears in the current release, SCOPe 2.08, called d1rf7a_
View in 3D