Lineage for d5wjja_ (5wjj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544248Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544249Species Human (Homo sapiens) [TaxId:9606] [56130] (202 PDB entries)
  8. 3048226Domain d5wjja_: 5wjj A: [348288]
    automated match to d4aaca_
    complexed with aqy

Details for d5wjja_

PDB Entry: 5wjj (more details), 1.6 Å

PDB Description: structure-based design, synthesis, and biological evaluation of imidazo[1,2-b]pyridazine-based p38 map kinase inhibitors
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d5wjja_:

Sequence, based on SEQRES records: (download)

>d5wjja_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d5wjja_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddatrwyra
peimlnwhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkis
sesarnyiqqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
ddepvadpydqsfesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d5wjja_:

Click to download the PDB-style file with coordinates for d5wjja_.
(The format of our PDB-style files is described here.)

Timeline for d5wjja_:

  • d5wjja_ is new in SCOPe 2.07-stable