Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) |
Family c.55.2.0: automated matches [238315] (1 protein) not a true family |
Protein automated matches [238316] (2 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [348284] (1 PDB entry) |
Domain d5wzea1: 5wze A:1-176 [348285] Other proteins in same PDB: d5wzea2, d5wzec2, d5wzed2 automated match to d2v3za1 complexed with ala, ca, edo, gol, mn, na, pge, pro, so4 |
PDB Entry: 5wze (more details), 1.78 Å
SCOPe Domain Sequences for d5wzea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wzea1 c.55.2.0 (A:1-176) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} miripkseyarrrkalmaqmepnsiailpaapmyirnrdvehvyrqdsdfqyltgfpepe avmalipgrahgeyvlfcrerdperelwdglragqdgaigqygaddafpigdiddilpgl iegrdrvyyalganpdfdrrlmdwinvirskarqgaqppnefvaldhllhdqrlyk
Timeline for d5wzea1:
View in 3D Domains from other chains: (mouse over for more information) d5wzec1, d5wzec2, d5wzed1, d5wzed2 |