SCOPe 2.08: Domain d5wzea1: 5wze A:1-176

Lineage for d5wzea1 (5wze A:1-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.0: automated matches [238315] (1 protein)
   not a true family

6. Protein automated matches [238316] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [348284] (1 PDB entry)

8. Domain d5wzea1: 5wze A:1-176 [348285]
   Other proteins in same PDB: d5wzea2, d5wzec2, d5wzed2
   automated match to d2v3za1
   complexed with ala, ca, edo, gol, mn, na, pge, pro, so4

Details for d5wzea1

PDB Entry: 5wze, 1.78 Å

PDB Description: the structure of pseudomonas aeruginosa aminopeptidase pepp

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d5wzea1:

Sequence; same for both SEQRES and ATOM records:

>d5wzea1 c.55.2.0 (A:1-176) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
miripkseyarrrkalmaqmepnsiailpaapmyirnrdvehvyrqdsdfqyltgfpepe
avmalipgrahgeyvlfcrerdperelwdglragqdgaigqygaddafpigdiddilpgl
iegrdrvyyalganpdfdrrlmdwinvirskarqgaqppnefvaldhllhdqrlyk

Timeline for d5wzea1:

• d5wzea1 first appeared in SCOPe 2.07