Lineage for d5wxvg_ (5wxv G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864405Species Vibrio anguillarum [TaxId:882102] [340428] (4 PDB entries)
  8. 2864422Domain d5wxvg_: 5wxv G: [348274]
    automated match to d5gleb_

Details for d5wxvg_

PDB Entry: 5wxv (more details), 2.3 Å

PDB Description: the crystal structure of vabb-icl domain from vibrio anguillarum 775
PDB Compounds: (G:) Isochorismate lyase

SCOPe Domain Sequences for d5wxvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wxvg_ c.33.1.0 (G:) automated matches {Vibrio anguillarum [TaxId: 882102]}
iasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellaniselks
larqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkwrysa
fkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsledhhh
tlkyitervgcvtsleal

SCOPe Domain Coordinates for d5wxvg_:

Click to download the PDB-style file with coordinates for d5wxvg_.
(The format of our PDB-style files is described here.)

Timeline for d5wxvg_: