Lineage for d5wska2 (5wsk A:150-464)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424105Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2424106Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2424311Protein automated matches [226984] (14 species)
    not a true protein
  7. 3048164Species Triticum aestivum [TaxId:4565] [348226] (1 PDB entry)
  8. 3048209Domain d5wska2: 5wsk A:150-464 [348271]
    Other proteins in same PDB: d5wska1, d5wskb1, d5wskc1, d5wskd1, d5wske_, d5wskf_, d5wskg_, d5wskh_
    automated match to d1ir2a1
    complexed with mg

Details for d5wska2

PDB Entry: 5wsk (more details), 1.78 Å

PDB Description: structure of ribulose-1,5-bisphosphate carboxylase/oxygenase from wheat
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5wska2:

Sequence, based on SEQRES records: (download)

>d5wska2 c.1.14.1 (A:150-464) automated matches {Triticum aestivum [TaxId: 4565]}
gpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsq
pfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdy
ltggftanttlahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihsg
tvvgklegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpa
lteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiiraac
kwspelaaacevwka

Sequence, based on observed residues (ATOM records): (download)

>d5wska2 c.1.14.1 (A:150-464) automated matches {Triticum aestivum [TaxId: 4565]}
gpphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsq
pfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdy
ltggftanttlahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihsg
tvvgegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpalt
eifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiiraackw
spelaaacevwka

SCOPe Domain Coordinates for d5wska2:

Click to download the PDB-style file with coordinates for d5wska2.
(The format of our PDB-style files is described here.)

Timeline for d5wska2:

  • d5wska2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06