Lineage for d5w08e_ (5w08 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776074Species Influenza a virus (a/texas/50/2012(h3n2)) [TaxId:1321009] [347902] (3 PDB entries)
  8. 2776080Domain d5w08e_: 5w08 E: [348268]
    Other proteins in same PDB: d5w08g_, d5w08h1, d5w08h2, d5w08i_, d5w08j1, d5w08j2, d5w08k_, d5w08l1, d5w08l2, d5w08m_, d5w08n1, d5w08n2, d5w08o_, d5w08p1, d5w08p2, d5w08q_, d5w08r1, d5w08r2
    automated match to d5umna_
    complexed with gol, nag

Details for d5w08e_

PDB Entry: 5w08 (more details), 2.6 Å

PDB Description: a/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5w08e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w08e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/texas/50/2012(h3n2)) [TaxId: 1321009]}
telvqnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysncyp
ydvpdyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlthlnf
kypalnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipnigf
rprirnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcks
ecitpngsipndkpfqnvnritygacpryvkqs

SCOPe Domain Coordinates for d5w08e_:

Click to download the PDB-style file with coordinates for d5w08e_.
(The format of our PDB-style files is described here.)

Timeline for d5w08e_: