![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5w08l2: 5w08 L:110-212 [348263] Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08g_, d5w08h1, d5w08i_, d5w08j1, d5w08k_, d5w08l1, d5w08m_, d5w08n1, d5w08o_, d5w08p1, d5w08q_, d5w08r1 automated match to d1mcol2 complexed with gol, nag |
PDB Entry: 5w08 (more details), 2.6 Å
SCOPe Domain Sequences for d5w08l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w08l2 b.1.1.2 (L:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d5w08l2: