Lineage for d5wutb_ (5wut B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780846Species Flavobacterium sp. [TaxId:239] [348242] (1 PDB entry)
  8. 2780848Domain d5wutb_: 5wut B: [348261]
    automated match to d3azza_

Details for d5wutb_

PDB Entry: 5wut (more details), 1.6 Å

PDB Description: crystal structure of laminarinase from flavobacterium sp. umi-01
PDB Compounds: (B:) ULam111

SCOPe Domain Sequences for d5wutb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wutb_ b.29.1.0 (B:) automated matches {Flavobacterium sp. [TaxId: 239]}
klvweehfngkeldtknwnfelgdgcpncgwgnserqlytktnhkmengklvitakkegt
qytstrittqgkkefqygyiearaklpvgkgiwpafwmlgsniktvgwpqcgeidileyv
gkephmvftslhttashgntintkrtridtieqgfhlyaidwtkdkmdffvdnilvytfn
ptdkteaiwpydqpfyfiinmaiggnfggpevddaifpqdfsidyikvyq

SCOPe Domain Coordinates for d5wutb_:

Click to download the PDB-style file with coordinates for d5wutb_.
(The format of our PDB-style files is described here.)

Timeline for d5wutb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5wuta_