SCOPe 2.08: Domain d5wyma1: 5wym A:9-121

Lineage for d5wyma1 (5wym A:9-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wyma1: 5wym A:9-121 [348258]
   Other proteins in same PDB: d5wyma3, d5wymc3
   automated match to d1rjlb1

Details for d5wyma1

PDB Entry: 5wym, 2.65 Å

PDB Description: crystal structure of an anti-connexin26 scfv

PDB Compounds: (A:) anti-connexin26 scFv,Ig heavy chain,Linker,anti-connexin26 scFv,Ig light chain

SCOPe Domain Sequences for d5wyma1:

Sequence; same for both SEQRES and ATOM records:

>d5wyma1 b.1.1.0 (A:9-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavishggsnkyyadsvkgrf
tisrdnskntlylqmnslraedtavyycardfswrgyymdvwgkgtlvtvssg

Timeline for d5wyma1:

• d5wyma1 first appeared in SCOPe 2.07