Lineage for d5vara2 (5var A:956-1004)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394271Protein automated matches [190752] (1 species)
    not a true protein
  7. 2394272Species Human (Homo sapiens) [TaxId:9606] [187947] (9 PDB entries)
  8. 2394277Domain d5vara2: 5var A:956-1004 [348238]
    automated match to d2qqra2
    complexed with 92y

Details for d5vara2

PDB Entry: 5var (more details), 1.83 Å

PDB Description: crystal structure of kdm4a tandem tudor domain in complex with a tri- methyl lysine competitive inhibitor
PDB Compounds: (A:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5vara2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vara2 b.34.9.1 (A:956-1004) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvy

SCOPe Domain Coordinates for d5vara2:

Click to download the PDB-style file with coordinates for d5vara2.
(The format of our PDB-style files is described here.)

Timeline for d5vara2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vara1