Lineage for d5wkla1 (5wkl A:1-304)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (35 species)
    not a true protein
  7. 2798472Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (14 PDB entries)
  8. 2798482Domain d5wkla1: 5wkl A:1-304 [348222]
    Other proteins in same PDB: d5wkla2
    automated match to d4wmea_
    complexed with avy, b3j

Details for d5wkla1

PDB Entry: 5wkl (more details), 1.85 Å

PDB Description: 1.85 a resolution structure of mers 3cl protease in complex with piperidine-based peptidomimetic inhibitor 17
PDB Compounds: (A:) Orf1a protein

SCOPe Domain Sequences for d5wkla1:

Sequence, based on SEQRES records: (download)

>d5wkla1 b.47.1.0 (A:1-304) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi
mgvv

Sequence, based on observed residues (ATOM records): (download)

>d5wkla1 b.47.1.0 (A:1-304) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhianlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlacyng
rptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelangthtgsafdgt
mygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalanqft
efvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqimgv
v

SCOPe Domain Coordinates for d5wkla1:

Click to download the PDB-style file with coordinates for d5wkla1.
(The format of our PDB-style files is described here.)

Timeline for d5wkla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wkla2