SCOP 1.59: Domain d4dfra_: 4dfr A:

Lineage for d4dfra_ (4dfr A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d4dfra_: 4dfr A: [34822]

Details for d4dfra_

PDB Entry: 4dfr, 1.7 Å

PDB Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate

SCOP Domain Sequences for d4dfra_:

Sequence; same for both SEQRES and ATOM records:

>d4dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfkilerr

Timeline for d4dfra_:

• d4dfra_ first appeared (with stable ids) in SCOP 1.55
  
• d4dfra_ appears in SCOP 1.57
  
• d4dfra_ appears in SCOP 1.61
  
• d4dfra_ appears in the current release, SCOPe 2.08