Lineage for d5wkcd2 (5wkc D:278-460)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2470886Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2470887Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2470907Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314108] (3 PDB entries)
  8. 2470914Domain d5wkcd2: 5wkc D:278-460 [348217]
    Other proteins in same PDB: d5wkca1, d5wkca3, d5wkcb1, d5wkcb3, d5wkcd1, d5wkcd3, d5wkce1, d5wkce3
    automated match to d1n0ha1
    complexed with auj, f50, fad, mg, pxd, tp9

Details for d5wkcd2

PDB Entry: 5wkc (more details), 2.33 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam
PDB Compounds: (D:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5wkcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkcd2 c.31.1.3 (D:278-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqg
lgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaa
egrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkke
ypy

SCOPe Domain Coordinates for d5wkcd2:

Click to download the PDB-style file with coordinates for d5wkcd2.
(The format of our PDB-style files is described here.)

Timeline for d5wkcd2: