Lineage for d5wkcd1 (5wkc D:84-269)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2472774Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2472775Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)
  7. 2472795Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314106] (3 PDB entries)
  8. 2472802Domain d5wkcd1: 5wkc D:84-269 [348216]
    Other proteins in same PDB: d5wkca2, d5wkca3, d5wkcb2, d5wkcb3, d5wkcd2, d5wkcd3, d5wkce2, d5wkce3
    automated match to d1n0ha2
    complexed with auj, f50, fad, mg, pxd, tp9

Details for d5wkcd1

PDB Entry: 5wkc (more details), 2.33 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam
PDB Compounds: (D:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5wkcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkcd1 c.36.1.5 (D:84-269) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgag
hmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqe
advvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
tkttlp

SCOPe Domain Coordinates for d5wkcd1:

Click to download the PDB-style file with coordinates for d5wkcd1.
(The format of our PDB-style files is described here.)

Timeline for d5wkcd1: