Lineage for d5uy8d2 (5uy8 D:201-592)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918664Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 2918701Protein automated matches [347771] (1 species)
    not a true protein
  7. 2918702Species Human (Homo sapiens) [TaxId:9606] [347772] (2 PDB entries)
  8. 2918710Domain d5uy8d2: 5uy8 D:201-592 [348215]
    Other proteins in same PDB: d5uy8a1, d5uy8b1, d5uy8c1, d5uy8d1
    automated match to d1pkxa2
    complexed with 8um, amz, mg

Details for d5uy8d2

PDB Entry: 5uy8 (more details), 2.39 Å

PDB Description: crystal structure of aicarft bound to an antifolate
PDB Compounds: (D:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d5uy8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uy8d2 c.97.1.4 (D:201-592) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcdalnawqlvkelkealgip
aaasfkhvspagaavgiplsedeakvcmvydlyktltpisaayarargadrmssfgdfva
lsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnycvlqmdqsykpdenevrt
lfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivatiavkytqsnsvcyakngq
vigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvkraeisnaidqyvtgtig
ededlikwkalfeevpellteaekkewvekltevsissdaffpfrdnvdrakrsgvayia
apsgsaadkvvieacdelgiilahtnlrlfhh

SCOPe Domain Coordinates for d5uy8d2:

Click to download the PDB-style file with coordinates for d5uy8d2.
(The format of our PDB-style files is described here.)

Timeline for d5uy8d2: