SCOPe 2.08: Domain d5uy8d1: 5uy8 D:4-200

Lineage for d5uy8d1 (5uy8 D:4-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.0: automated matches [347767] (1 protein)
   not a true family

6. Protein automated matches [347768] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [347769] (2 PDB entries)

8. Domain d5uy8d1: 5uy8 D:4-200 [348214]
   Other proteins in same PDB: d5uy8a2, d5uy8b2, d5uy8c2, d5uy8d2
   automated match to d1pkxb1
   complexed with 8um, amz, mg

Details for d5uy8d1

PDB Entry: 5uy8, 2.39 Å

PDB Description: crystal structure of aicarft bound to an antifolate

PDB Compounds: (D:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d5uy8d1:

Sequence; same for both SEQRES and ATOM records:

>d5uy8d1 c.24.1.0 (D:4-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
qydeaisdyfrkqyskg

Timeline for d5uy8d1:

• d5uy8d1 first appeared in SCOPe 2.07