Lineage for d5uy8d1 (5uy8 D:4-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859693Family c.24.1.0: automated matches [347767] (1 protein)
    not a true family
  6. 2859694Protein automated matches [347768] (3 species)
    not a true protein
  7. 2859721Species Human (Homo sapiens) [TaxId:9606] [347769] (2 PDB entries)
  8. 2859729Domain d5uy8d1: 5uy8 D:4-200 [348214]
    Other proteins in same PDB: d5uy8a2, d5uy8b2, d5uy8c2, d5uy8d2
    automated match to d1pkxb1
    complexed with 8um, amz, mg

Details for d5uy8d1

PDB Entry: 5uy8 (more details), 2.39 Å

PDB Description: crystal structure of aicarft bound to an antifolate
PDB Compounds: (D:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d5uy8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uy8d1 c.24.1.0 (D:4-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
qydeaisdyfrkqyskg

SCOPe Domain Coordinates for d5uy8d1:

Click to download the PDB-style file with coordinates for d5uy8d1.
(The format of our PDB-style files is described here.)

Timeline for d5uy8d1: