Lineage for d5uzqa_ (5uzq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330826Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2330827Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2330828Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2330894Protein automated matches [190675] (10 species)
    not a true protein
  7. 3047865Species Homo sapiens [TaxId:9606] [347927] (3 PDB entries)
  8. 3048147Domain d5uzqa_: 5uzq A: [348209]
    automated match to d3enja_

Details for d5uzqa_

PDB Entry: 5uzq (more details), 2.16 Å

PDB Description: crystal structure of citrate synthase from homo sapiens
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d5uzqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzqa_ a.103.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
stnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldpde
girfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraalps
hvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdliakl
pcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpndpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmsteglmkfvds

SCOPe Domain Coordinates for d5uzqa_:

Click to download the PDB-style file with coordinates for d5uzqa_.
(The format of our PDB-style files is described here.)

Timeline for d5uzqa_:

  • d5uzqa_ is new in SCOPe 2.07-stable