![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314110] (3 PDB entries) |
![]() | Domain d5wkca3: 5wkc A:461-687 [348198] Other proteins in same PDB: d5wkca1, d5wkca2, d5wkcb1, d5wkcb2, d5wkcd1, d5wkcd2, d5wkce1, d5wkce2 automated match to d1n0ha3 complexed with auj, f50, fad, mg, pxd, tp9 |
PDB Entry: 5wkc (more details), 2.33 Å
SCOPe Domain Sequences for d5wkca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wkca3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
Timeline for d5wkca3: