Lineage for d5vcjd2 (5vcj D:113-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758486Domain d5vcjd2: 5vcj D:113-240 [348183]
    Other proteins in same PDB: d5vcja1, d5vcjb_, d5vcjc2
    automated match to d3q5ya2
    complexed with n57, nag, plm

Details for d5vcjd2

PDB Entry: 5vcj (more details), 3.16 Å

PDB Description: structure of alpha-galactosylphytosphingosine bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (D:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d5vcjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vcjd2 b.1.1.0 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d5vcjd2:

Click to download the PDB-style file with coordinates for d5vcjd2.
(The format of our PDB-style files is described here.)

Timeline for d5vcjd2: