SCOPe 2.08: Domain d5vcjd1: 5vcj D:2-112

Lineage for d5vcjd1 (5vcj D:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5vcjd1: 5vcj D:2-112 [348182]
   Other proteins in same PDB: d5vcja1, d5vcjb_, d5vcjc2
   automated match to d3q5ya1
   complexed with n57, nag, plm

Details for d5vcjd1

PDB Entry: 5vcj, 3.16 Å

PDB Description: structure of alpha-galactosylphytosphingosine bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (D:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d5vcjd1:

Sequence; same for both SEQRES and ATOM records:

>d5vcjd1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d5vcjd1:

• d5vcjd1 first appeared in SCOPe 2.07