Lineage for d1ezrc_ (1ezr C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843099Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 843100Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family) (S)
  5. 843101Family c.70.1.1: Nucleoside hydrolase [53591] (4 proteins)
  6. 843126Protein Nucleoside hydrolase [53594] (1 species)
  7. 843127Species Leishmania major [TaxId:5664] [53595] (1 PDB entry)
  8. 843130Domain d1ezrc_: 1ezr C: [34818]

Details for d1ezrc_

PDB Entry: 1ezr (more details), 2.5 Å

PDB Description: crystal structure of nucleoside hydrolase from leishmania major
PDB Compounds: (C:) nucleoside hydrolase

SCOP Domain Sequences for d1ezrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezrc_ c.70.1.1 (C:) Nucleoside hydrolase {Leishmania major [TaxId: 5664]}
prkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivgv
pvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkti
tlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivfn
eswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvhd
pcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfwc
lvidalerigdp

SCOP Domain Coordinates for d1ezrc_:

Click to download the PDB-style file with coordinates for d1ezrc_.
(The format of our PDB-style files is described here.)

Timeline for d1ezrc_: