Lineage for d5vfhb1 (5vfh B:2-133)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346111Species Bothrops pauloensis [TaxId:1042543] [343230] (4 PDB entries)
  8. 2346113Domain d5vfhb1: 5vfh B:2-133 [348177]
    Other proteins in same PDB: d5vfha2, d5vfhb2
    automated match to d1pa0a_
    complexed with so4

Details for d5vfhb1

PDB Entry: 5vfh (more details), 1.59 Å

PDB Description: cristal structure of bnsp-7 from bothrops pauloensis complexed to sulfates
PDB Compounds: (B:) Basic phospholipase A2 homolog BnSP-7

SCOPe Domain Sequences for d5vfhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfhb1 a.133.1.2 (B:2-133) Snake phospholipase A2 {Bothrops pauloensis [TaxId: 1042543]}
lfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpkk
drysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadpc

SCOPe Domain Coordinates for d5vfhb1:

Click to download the PDB-style file with coordinates for d5vfhb1.
(The format of our PDB-style files is described here.)

Timeline for d5vfhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vfhb2