SCOPe 2.08: Domain d5w21c2: 5w21 C:250-361

Lineage for d5w21c2 (5w21 C:250-361)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5w21c2: 5w21 C:250-361 [348176]
   automated match to d3ojvc2
   complexed with nag, zn

Details for d5w21c2

PDB Entry: 5w21, 3 Å

PDB Description: crystal structure of a 1:1:1 fgf23-fgfr1c-aklotho ternary complex

PDB Compounds: (C:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d5w21c2:

Sequence; same for both SEQRES and ATOM records:

>d5w21c2 b.1.1.0 (C:250-361) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsphrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvq
ilktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvlea

Timeline for d5w21c2:

• d5w21c2 first appeared in SCOPe 2.07