Lineage for d5uzpb_ (5uzp B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336030Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2336031Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2336032Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2336098Protein automated matches [190675] (10 species)
    not a true protein
  7. 2336113Species Homo sapiens [TaxId:9606] [347927] (3 PDB entries)
  8. 2336116Domain d5uzpb_: 5uzp B: [348171]
    automated match to d3enja_
    complexed with oaa; mutant

Details for d5uzpb_

PDB Entry: 5uzp (more details), 2.29 Å

PDB Description: crystal structure of citrate synthase mutant a348g from homo sapiens
PDB Compounds: (B:) Citrate synthase, mitochondrial

SCOPe Domain Sequences for d5uzpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzpb_ a.103.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]}
asstnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldp
degirfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraal
pshvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdlia
klpcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheg
gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
lrdyiwntlnsgrvvpgyghgvlrktdprytcqrefalkhlpndpmfklvaqlykivpnv
lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
rpksmsteglmkfvds

SCOPe Domain Coordinates for d5uzpb_:

Click to download the PDB-style file with coordinates for d5uzpb_.
(The format of our PDB-style files is described here.)

Timeline for d5uzpb_: