Lineage for d5uzpb_ (5uzp B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. Protein automated matches [190675] (10 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [347927] (3 PDB entries)
  8. Domain d5uzpb_: 5uzp B: [348171]
    automated match to d3enja_
    complexed with oaa; mutant

Details for d5uzpb_

PDB Entry: 5uzp (more details), 2.29 Å

PDB Description: crystal structure of citrate synthase mutant a348g from homo sapiens
PDB Compounds: (B:) Citrate synthase, mitochondrial

SCOPe Domain Sequences for d5uzpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzpb_ a.103.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asstnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldp
degirfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraal
pshvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdlia
klpcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheg
gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
lrdyiwntlnsgrvvpgyghgvlrktdprytcqrefalkhlpndpmfklvaqlykivpnv
lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
rpksmsteglmkfvds

SCOPe Domain Coordinates for d5uzpb_ are not available.

Timeline for d5uzpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5uzpa_