Lineage for d1ezrb_ (1ezr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903313Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2903314Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2903315Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2903336Protein Nucleoside hydrolase [53594] (1 species)
  7. 2903337Species Leishmania major [TaxId:5664] [53595] (1 PDB entry)
  8. 2903339Domain d1ezrb_: 1ezr B: [34817]
    complexed with ca

Details for d1ezrb_

PDB Entry: 1ezr (more details), 2.5 Å

PDB Description: crystal structure of nucleoside hydrolase from leishmania major
PDB Compounds: (B:) nucleoside hydrolase

SCOPe Domain Sequences for d1ezrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezrb_ c.70.1.1 (B:) Nucleoside hydrolase {Leishmania major [TaxId: 5664]}
prkiildcdpgiddavaiflahgnpeiellaittvvgnqslekvtqnarlvadvagivgv
pvaagctkplvrgvrnashihgetgmgnvsyppefktkldgrhavqliidlimshepkti
tlvptggltniamavrleprivdrvkevvlmgggyhtgnaspvaefnvfidpeaahivfn
eswnvtmvgldlthlalatpavqkrvrevgtkpaafmlqildfytkvyekehdtygkvhd
pcavayvidptvmttervpvdielngalttgmtvadfryprpkncrtqvavkldfdkfwc
lvidalerigdp

SCOPe Domain Coordinates for d1ezrb_:

Click to download the PDB-style file with coordinates for d1ezrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ezrb_: