Lineage for d5ufwa_ (5ufw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335233Protein Estrogen receptor alpha [48519] (1 species)
  7. 2335234Species Human (Homo sapiens) [TaxId:9606] [48520] (71 PDB entries)
    Uniprot P03372 307-551
  8. 3048078Domain d5ufwa_: 5ufw A: [348140]
    automated match to d3erta_
    complexed with 86v

Details for d5ufwa_

PDB Entry: 5ufw (more details), 1.58 Å

PDB Description: estrogen receptor alpha ligand binding domain in complex with op1154
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d5ufwa_:

Sequence, based on SEQRES records: (download)

>d5ufwa_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldahr

Sequence, based on observed residues (ATOM records): (download)

>d5ufwa_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
latssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlma
kagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldahr

SCOPe Domain Coordinates for d5ufwa_:

Click to download the PDB-style file with coordinates for d5ufwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ufwa_:

  • d5ufwa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06