Lineage for d1masa_ (1mas A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136748Protein Inosine-uridine nucleoside N-ribohydrolase, IU-NH [53592] (1 species)
  7. 2136749Species Crithidia fasciculata [TaxId:5656] [53593] (2 PDB entries)
  8. 2136754Domain d1masa_: 1mas A: [34814]
    complexed with k

Details for d1masa_

PDB Entry: 1mas (more details), 2.5 Å

PDB Description: purine nucleoside hydrolase
PDB Compounds: (A:) inosine-uridine nucleoside n-ribohydrolase

SCOPe Domain Sequences for d1masa_:

Sequence, based on SEQRES records: (download)

>d1masa_ c.70.1.1 (A:) Inosine-uridine nucleoside N-ribohydrolase, IU-NH {Crithidia fasciculata [TaxId: 5656]}
akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
piaagcdkplvrkimtaghihgesgmgtvaypaefknkvderhavnliidlvmshepkti
tlvptggltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfn
eswqvtmvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavh
dpcavayvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfw
glvldalerigdpq

Sequence, based on observed residues (ATOM records): (download)

>d1masa_ c.70.1.1 (A:) Inosine-uridine nucleoside N-ribohydrolase, IU-NH {Crithidia fasciculata [TaxId: 5656]}
akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
piaagcdkplvrkimtesgmgtvaypaefknkvderhavnliidlvmshepktitlvptg
gltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfneswqvt
mvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavhdpcava
yvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfwglvlda
lerigdpq

SCOPe Domain Coordinates for d1masa_:

Click to download the PDB-style file with coordinates for d1masa_.
(The format of our PDB-style files is described here.)

Timeline for d1masa_: