Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Bothrops pauloensis [TaxId:1042543] [343230] (4 PDB entries) |
Domain d5vfha1: 5vfh A:2-133 [348136] Other proteins in same PDB: d5vfha2, d5vfhb2 automated match to d1pa0a_ complexed with so4 |
PDB Entry: 5vfh (more details), 1.59 Å
SCOPe Domain Sequences for d5vfha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vfha1 a.133.1.2 (A:2-133) Snake phospholipase A2 {Bothrops pauloensis [TaxId: 1042543]} lfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpkk drysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadpc
Timeline for d5vfha1: