Lineage for d5wegb1 (5weg B:13-390)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2473405Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins)
  6. 2473455Protein automated matches [226998] (4 species)
    not a true protein
  7. 3048012Species Saccharum hybrid [TaxId:193079] [348074] (1 PDB entry)
  8. 3048069Domain d5wegb1: 5weg B:13-390 [348131]
    Other proteins in same PDB: d5wega2, d5wegb2
    automated match to d2icyb2
    complexed with edo, so4

Details for d5wegb1

PDB Entry: 5weg (more details), 2 Å

PDB Description: crystal structure of udp-glucose pyrophosphorylase from sugarcane
PDB Compounds: (B:) UTP--glucose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d5wegb1:

Sequence, based on SEQRES records: (download)

>d5wegb1 c.68.1.5 (B:13-390) automated matches {Saccharum hybrid [TaxId: 193079]}
ekldklraevakldqisenekagfislvsrylsgeaeqiewskiqtptdevvvpydtlas
ppedleetkklldklvvlklngglgttmgctgpksvievrngftfldliviqieslnkky
gcsvplllmnsfnthddtqkivekysnsnieihtfnqsqyprivtedflplpskgksgkd
gwyppghgdvfpslnnsgkldillaqgkeyvfiansdnlgaivdikilnhlinnqneycm
evtpktladvkggtlisyegrvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaik
rlveaealkmeiipnpkevdgvkvlqletaagaairffdkaiginvprsrflpvkatsdl
llvqsdlytlvdgfvirn

Sequence, based on observed residues (ATOM records): (download)

>d5wegb1 c.68.1.5 (B:13-390) automated matches {Saccharum hybrid [TaxId: 193079]}
ekldklraevakldqisenekagfislvsrylsgiewskiqtptdevvvpydtladleet
kklldklvvlklngglgttmgctgpksvievrngftfldliviqieslnkkygcsvplll
mnsfnthddtqkivekysnsnieihtfnqsqyprivtedflplpsgkdgwyppghgdvfp
slnnsgkldillaqgkeyvfiansdnlgaivdikilnhlinnqneycmevtpktladvkg
gtlisyegrvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikrlveaealkmei
ipnpkevdgvkvlqletaagaairffdkaiginvprsrflpvkatsdlllvqsdlytlvd
gfvirn

SCOPe Domain Coordinates for d5wegb1:

Click to download the PDB-style file with coordinates for d5wegb1.
(The format of our PDB-style files is described here.)

Timeline for d5wegb1:

  • d5wegb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5wegb2