Lineage for d2masd_ (2mas D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510775Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2510776Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2510777Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2510790Protein Inosine-uridine nucleoside N-ribohydrolase, IU-NH [53592] (1 species)
  7. 2510791Species Crithidia fasciculata [TaxId:5656] [53593] (2 PDB entries)
  8. 2510795Domain d2masd_: 2mas D: [34813]
    complexed with ca, pir

Details for d2masd_

PDB Entry: 2mas (more details), 2.3 Å

PDB Description: purine nucleoside hydrolase with a transition state inhibitor
PDB Compounds: (D:) inosine-uridine nucleoside n-ribohydrolase

SCOPe Domain Sequences for d2masd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2masd_ c.70.1.1 (D:) Inosine-uridine nucleoside N-ribohydrolase, IU-NH {Crithidia fasciculata [TaxId: 5656]}
akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv
piaagcdkplvrkimtaghihgesgmgtvaypaefknkvderhavnliidlvmshepkti
tlvptggltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfn
eswqvtmvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavh
dpcavayvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfw
glvldalerigdp

SCOPe Domain Coordinates for d2masd_:

Click to download the PDB-style file with coordinates for d2masd_.
(The format of our PDB-style files is described here.)

Timeline for d2masd_: