![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) ![]() |
![]() | Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
![]() | Protein Inosine-uridine nucleoside N-ribohydrolase, IU-NH [53592] (1 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [53593] (2 PDB entries) |
![]() | Domain d2masd_: 2mas D: [34813] complexed with ca, pir |
PDB Entry: 2mas (more details), 2.3 Å
SCOPe Domain Sequences for d2masd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2masd_ c.70.1.1 (D:) Inosine-uridine nucleoside N-ribohydrolase, IU-NH {Crithidia fasciculata [TaxId: 5656]} akkiildcdpglddavaillahgnpeiellaittvvgnqtlakvtrnaqlvadiagitgv piaagcdkplvrkimtaghihgesgmgtvaypaefknkvderhavnliidlvmshepkti tlvptggltniamaarleprivdrvkevvlmgggyhegnatsvaefniiidpeaahivfn eswqvtmvgldlthqalatppilqrvkevdtnparfmleimdyytkiyqsnrymaaaavh dpcavayvidpsvmttervpvdieltgkltlgmtvadfrnprpehchtqvavkldfekfw glvldalerigdp
Timeline for d2masd_: