Lineage for d5vfnb1 (5vfn B:2-133)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733073Species Bothrops pauloensis [TaxId:1042543] [343230] (4 PDB entries)
  8. 2733081Domain d5vfnb1: 5vfn B:2-133 [348129]
    Other proteins in same PDB: d5vfna2, d5vfnb2
    automated match to d1pa0a_
    complexed with hci, me2, so4

Details for d5vfnb1

PDB Entry: 5vfn (more details), 2.39 Å

PDB Description: crystal structure of bnsp-7 from bothrops pauloensis complexed with cinnamic acid
PDB Compounds: (B:) Basic phospholipase A2 homolog BnSP-7

SCOPe Domain Sequences for d5vfnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfnb1 a.133.1.2 (B:2-133) Snake phospholipase A2 {Bothrops pauloensis [TaxId: 1042543]}
lfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpkk
drysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadpc

SCOPe Domain Coordinates for d5vfnb1:

Click to download the PDB-style file with coordinates for d5vfnb1.
(The format of our PDB-style files is described here.)

Timeline for d5vfnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vfnb2