Lineage for d5oy0a_ (5oy0 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633179Species Synechocystis sp. [TaxId:1111708] [347297] (2 PDB entries)
  8. 2633182Domain d5oy0a_: 5oy0 A: [348113]
    Other proteins in same PDB: d5oy00_, d5oy03_, d5oy04_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_
    automated match to d4y28a_
    complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd

Details for d5oy0a_

PDB Entry: 5oy0 (more details), 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d5oy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oy0a_ f.29.1.1 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mtisppereakakvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfds
qtsdledvsrkifsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpi
vgqgilngdvgggfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhy
hvkapklewfqnvesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplph
efilepskmaelypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlai
avlfiiaghmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallg
sltiivaqhmyamppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpak
nvnnlldrmlrhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqp
ifaqwvqhlhtlapgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaf
tihvtalillkgvlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyn
slsivifhfswkmqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvins
ygsalsaygimflaghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsi
iqgravgvahyllggivttwafflarslsig

SCOPe Domain Coordinates for d5oy0a_:

Click to download the PDB-style file with coordinates for d5oy0a_.
(The format of our PDB-style files is described here.)

Timeline for d5oy0a_: