SCOPe 2.08: Domain d5vcjc2: 5vcj C:116-204

Lineage for d5vcjc2 (5vcj C:116-204)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)

8. Domain d5vcjc2: 5vcj C:116-204 [348112]
   Other proteins in same PDB: d5vcja1, d5vcja2, d5vcjb_, d5vcjc1, d5vcjd1, d5vcjd2
   automated match to d2pyfa2
   complexed with n57, nag, plm

Details for d5vcjc2

PDB Entry: 5vcj, 3.16 Å

PDB Description: structure of alpha-galactosylphytosphingosine bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d5vcjc2:

Sequence, based on SEQRES records:

>d5vcjc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d5vcjc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkfacanafnnsiipedtffps

Timeline for d5vcjc2:

• d5vcjc2 first appeared in SCOPe 2.07