Lineage for d5vcjc2 (5vcj C:116-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749758Domain d5vcjc2: 5vcj C:116-204 [348112]
    Other proteins in same PDB: d5vcja1, d5vcja2, d5vcjb_, d5vcjc1, d5vcjd1, d5vcjd2
    automated match to d2pyfa2
    complexed with n57, nag, plm

Details for d5vcjc2

PDB Entry: 5vcj (more details), 3.16 Å

PDB Description: structure of alpha-galactosylphytosphingosine bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d5vcjc2:

Sequence, based on SEQRES records: (download)

>d5vcjc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d5vcjc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkfacanafnnsiipedtffps

SCOPe Domain Coordinates for d5vcjc2:

Click to download the PDB-style file with coordinates for d5vcjc2.
(The format of our PDB-style files is described here.)

Timeline for d5vcjc2: