SCOPe 2.07: Domain d5vcja1: 5vcj A:7-185

Lineage for d5vcja1 (5vcj A:7-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d5vcja1: 5vcj A:7-185 [348108]
   Other proteins in same PDB: d5vcja2, d5vcjb_, d5vcjc1, d5vcjc2, d5vcjd1, d5vcjd2
   automated match to d1zt4c2
   complexed with bma, fuc, man, nag, pbs, plm

Details for d5vcja1

PDB Entry: 5vcj, 3.16 Å

PDB Description: structure of alpha-galactosylphytosphingosine bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d5vcja1:

Sequence; same for both SEQRES and ATOM records:

>d5vcja1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d5vcja1:

• d5vcja1 is new in SCOPe 2.07-stable
  
• d5vcja1 appears in the current release, SCOPe 2.08