Lineage for d5vcja1 (5vcj A:7-185)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. Protein automated matches [226842] (5 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. Domain d5vcja1: 5vcj A:7-185 [348108]
    Other proteins in same PDB: d5vcja2, d5vcjb_, d5vcjc1, d5vcjc2, d5vcjd1, d5vcjd2
    automated match to d1zt4c2
    complexed with n57, nag, plm

Details for d5vcja1

PDB Entry: 5vcj (more details), 3.16 Å

PDB Description: structure of alpha-galactosylphytosphingosine bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d5vcja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vcja1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d5vcja1 are not available.

Timeline for d5vcja1:

Domains from same chain:
(mouse over for more information)
d5vcja2
Domains from other chains:
(mouse over for more information)
d5vcjb_, d5vcjc1, d5vcjc2, d5vcjd1, d5vcjd2