SCOPe 2.07: Domain d5urea1: 5ure A:62-235

Lineage for d5urea1 (5ure A:62-235)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)

8. Domain d5urea1: 5ure A:62-235 [348093]
   Other proteins in same PDB: d5urea2, d5urea3, d5ureb2, d5ureb3
   automated match to d1ja1a2
   complexed with fad, fmn, nap, po4

Details for d5urea1

PDB Entry: 5ure, 2.3 Å

PDB Description: wild type rat cypor bound with nadp+ - reduced form

PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5urea1:

Sequence; same for both SEQRES and ATOM records:

>d5urea1 c.23.5.0 (A:62-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad
lsslpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehf
namgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

Timeline for d5urea1:

• d5urea1 is new in SCOPe 2.07-stable
  
• d5urea1 appears in the current release, SCOPe 2.08