Lineage for d1dwqb_ (1dwq B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590684Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)
  6. 590685Protein Hydroxynitrile lyase [53586] (2 species)
  7. 590686Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (7 PDB entries)
  8. 590700Domain d1dwqb_: 1dwq B: [34809]
    complexed with ato, csa

Details for d1dwqb_

PDB Entry: 1dwq (more details), 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis

SCOP Domain Sequences for d1dwqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwqb_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta)}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgesxaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

SCOP Domain Coordinates for d1dwqb_:

Click to download the PDB-style file with coordinates for d1dwqb_.
(The format of our PDB-style files is described here.)

Timeline for d1dwqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dwqa_