Lineage for d5wdda_ (5wdd A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021541Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 3021542Protein automated matches [195066] (5 species)
    not a true protein
  7. 3021543Species Chicken (Gallus gallus) [TaxId:9031] [348036] (1 PDB entry)
  8. 3021544Domain d5wdda_: 5wdd A: [348084]
    automated match to d2imsa_
    complexed with edo

Details for d5wdda_

PDB Entry: 5wdd (more details), 1.8 Å

PDB Description: crystal structure of chicken bok
PDB Compounds: (A:) Bcl-2-related ovarian killer protein

SCOPe Domain Sequences for d5wdda_:

Sequence, based on SEQRES records: (download)

>d5wdda_ f.1.4.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sptdkelvsqakalcrdyinsrliragvswskpehntpvpggklaevsaillrlgdeley
irpnvyrniarqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaaglavdcvr
haqpamvhtivdclgefvrktlvtwlkrrggwaditkcvv

Sequence, based on observed residues (ATOM records): (download)

>d5wdda_ f.1.4.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sptdkelvsqakalcrdyinsrliragvswsgklaevsaillrlgdeleyirpnvyrnia
rqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaaglavdcvrhaqpamvhti
vdclgefvrktlvtwlkrrggwaditkcvv

SCOPe Domain Coordinates for d5wdda_:

Click to download the PDB-style file with coordinates for d5wdda_.
(The format of our PDB-style files is described here.)

Timeline for d5wdda_: