Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Saccharum hybrid [TaxId:193079] [348076] (1 PDB entry) |
Domain d5wega2: 5weg A:391-476 [348077] Other proteins in same PDB: d5wega1, d5wegb1 automated match to d2icyb1 complexed with edo, so4 |
PDB Entry: 5weg (more details), 2 Å
SCOPe Domain Sequences for d5wega2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wega2 b.81.1.0 (A:391-476) automated matches {Saccharum hybrid [TaxId: 193079]} paranpanpsielgpefkkvanflarfksipsiveldslkvsgdvwfgsgitlkgkvtit aksgvkleipdgavlenkdvngpedl
Timeline for d5wega2: