SCOPe 2.08: Domain d5wega2: 5weg A:391-476

Lineage for d5wega2 (5weg A:391-476)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Saccharum hybrid [TaxId:193079] [348076] (1 PDB entry)

8. Domain d5wega2: 5weg A:391-476 [348077]
   Other proteins in same PDB: d5wega1, d5wegb1
   automated match to d2icyb1
   complexed with edo, so4

Details for d5wega2

PDB Entry: 5weg, 2 Å

PDB Description: crystal structure of udp-glucose pyrophosphorylase from sugarcane

PDB Compounds: (A:) UTP--glucose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d5wega2:

Sequence; same for both SEQRES and ATOM records:

>d5wega2 b.81.1.0 (A:391-476) automated matches {Saccharum hybrid [TaxId: 193079]}
paranpanpsielgpefkkvanflarfksipsiveldslkvsgdvwfgsgitlkgkvtit
aksgvkleipdgavlenkdvngpedl

Timeline for d5wega2:

• d5wega2 first appeared in SCOPe 2.07